PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943745.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 239aa    MW: 27277.7 Da    PI: 9.2418
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943745.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.41.8e-46141381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yL++k+ + +l++ +vi+e+d+ k++PwdLp    ++e+e yfF  r+ ky +gkr +rat sgyWkatg+dk+++++
  XP_010943745.1  14 LPPGFRFHPTDEELVVHYLTRKAFSFPLPA-TVIPEIDLGKFDPWDLP---GGSEEERYFFNLREAKYLNGKRFKRATMSGYWKATGRDKPIIAS 104
                     79****************************.99***************...4578899*********************************9988 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++lvg kk Lvfy+g+ p+++ tdW+mheyrl
  XP_010943745.1 105 rCNQLVGWKKDLVFYRGKPPHASPTDWIMHEYRL 138
                     68889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-5310173IPR003441NAC domain
PROSITE profilePS5100554.18314173IPR003441NAC domain
PfamPF023655.9E-2415138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MEKPDFIKYG VQKLPPGFRF HPTDEELVVH YLTRKAFSFP LPATVIPEID LGKFDPWDLP  60
GGSEEERYFF NLREAKYLNG KRFKRATMSG YWKATGRDKP IIASRCNQLV GWKKDLVFYR  120
GKPPHASPTD WIMHEYRLAA TETSASGFSQ RKFSAHSSMA HTKEWVVCRI FRKRRATRMD  180
AEITPYYNYS RIRSNIEHID PDASVSSSSS SSSCVTDLSE DGEEGSSNSM ASSPNGREV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-451417817170NO APICAL MERISTEM PROTEIN
1ut4_B6e-451417817170NO APICAL MERISTEM PROTEIN
1ut7_A6e-451417817170NO APICAL MERISTEM PROTEIN
1ut7_B6e-451417817170NO APICAL MERISTEM PROTEIN
4dul_A6e-451417817170NAC domain-containing protein 19
4dul_B6e-451417817170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943745.11e-180PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY933e-72NAC83_ARATH; NAC domain-containing protein 83
TrEMBLB3TLL03e-92B3TLL0_ELAGV; ANAC083 transcription factor
STRINGGSMUA_Achr6P23840_0012e-85(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63173254
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.16e-73NAC domain containing protein 83